NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold CVPL010W_10082131

Scaffold CVPL010W_10082131


Overview

Basic Information
Taxon OID3300002931 Open in IMG/M
Scaffold IDCVPL010W_10082131 Open in IMG/M
Source Dataset NameAnt worker gut metagenome for colony PL010
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterHarvard University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)543
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Cephalotes Varians → Cephalotes Varians Microbial Communities From The Florida Keys, Usa

Source Dataset Sampling Location
Location NameUSA: North Key Largo, Florida
CoordinatesLat. (o)25.2845833Long. (o)-80.3122167Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059647Metagenome133Y

Sequences

Protein IDFamilyRBSSequence
CVPL010W_100821311F059647N/AMASTGPV*PVVVNGGQLWSRIPSLNELVHFKAELRDLGLVYQVIASTAL*DKIGQISSK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.