NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0052187_10046

Scaffold Ga0052187_10046


Overview

Basic Information
Taxon OID3300003086 Open in IMG/M
Scaffold IDGa0052187_10046 Open in IMG/M
Source Dataset NameMarine viral communities from deep ocean hydrothermal plumes from the Lau and Guaymas Basin
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)50322
Total Scaffold Genes32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (84.38%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Guaymas Basin, Pacific Ocean

Source Dataset Sampling Location
Location NameLau and Guaymas Basin
CoordinatesLat. (o)-20.053234Long. (o)-176.133763Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F105866Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0052187_1004610F105866GAGGMATEDTGFTQIPYVRKDDTFKEWRERTNLMIQQQNNFVRMQEFDMLGVSDVWVKTSMQLNYSGETEN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.