NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0052244_1028448

Scaffold Ga0052244_1028448


Overview

Basic Information
Taxon OID3300003144 Open in IMG/M
Scaffold IDGa0052244_1028448 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from deep subseafloor - Sample from 18.6 mbsf
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJapan Agency for Marine-Earth Science and Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)805
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Deep Subseafloor

Source Dataset Sampling Location
Location NameNorthwestern Pacific Ocean
CoordinatesLat. (o)41.1773Long. (o)142.2013Alt. (m)Depth (m)1180.5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080857Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0052244_10284481F080857GGAMSGNERGGETFLAKVYKGWRITVYEPVREYLDLEIGDTLRVTVQKDERRARP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.