 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300003279 Open in IMG/M |
| Scaffold ID | FCL3draft_1002408 Open in IMG/M |
| Source Dataset Name | Down-flow hanging sponge reactor microbial communities from the University of Illinois at Urbana-Champaign, USA - U3-798FC-DHS |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 13878 |
| Total Scaffold Genes | 13 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (23.08%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor → Down-Flow Hanging Sponge Reactor Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: University of Illionis | |||||||
| Coordinates | Lat. (o) | 40.114056 | Long. (o) | -88.226756 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014824 | Metagenome / Metatranscriptome | 259 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FCL3draft_10024081 | F014824 | N/A | KSRGVFTPVYSTHLNLPYIHSNNILTVTNNKNTTIFTINPLDQITKGTIDIIINSKSKIKKMIQKMKNRKDTGNTLTLKESNPHSNPSDLIIFDLTNKLPTPITKGITKEINK* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |