NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LKpool_1044740

Scaffold LKpool_1044740


Overview

Basic Information
Taxon OID3300003311 Open in IMG/M
Scaffold IDLKpool_1044740 Open in IMG/M
Source Dataset NameLooe Key pool
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)509
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Faviina → Merulinidae → Orbicella → Orbicella faveolata(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Cnidaria → Cnidaria Microbial Communities From The Caribbean, With Black Band Disease

Source Dataset Sampling Location
Location NameLooe Key National Marine Sanctuary, Florida, USA
CoordinatesLat. (o)24.5484806Long. (o)-81.4059137Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F091323Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
LKpool_10447401F091323N/AMAKWWQAPGVAQKAVIAKAKAWSNFLKHFPKADKSRFIAEPHFDEKLNATAEVFFKESGGSLKSVFGSDRQYWSAEMKRALGLGDSGGFPYQLSPLGSKASLPIPAEPFDGKAPSLKKIFNTDIKIFVTPDRYFTTKFREIFQKTKLRH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.