NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold soilH2_10267741

Scaffold soilH2_10267741


Overview

Basic Information
Taxon OID3300003324 Open in IMG/M
Scaffold IDsoilH2_10267741 Open in IMG/M
Source Dataset NameSugarcane bulk soil Sample H2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1675
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location
Location NameAyr, Queensland Australia
CoordinatesLat. (o)-19.733298Long. (o)147.17873Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011803Metagenome / Metatranscriptome287Y
F023966Metagenome / Metatranscriptome208Y
F044745Metagenome / Metatranscriptome154Y
F061313Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
soilH2_102677411F044745N/AMNKQNRVLLRQGARALTDQEVAIVAGGLTTLTACTFAAAGTADGDTFHSECGSPDL*
soilH2_102677412F011803AGGAGMNNQNRVLIRRGARELTPVESDLVNGGFITLSPCTSSPSPDGDQHVGEVGC*
soilH2_102677413F061313AGGAGMNDQNRVLARRGARDLTGEEVEQVCGGFRTATKCSVTAAGAIDGDLHECS*
soilH2_102677415F023966GGAGGMDQDNRVLTRRGARELSEQEVETVTGAFKVRHMLTPCFVDSKQQFLNGDQAIGECGP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.