NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI20214J51088_10158654

Scaffold JGI20214J51088_10158654


Overview

Basic Information
Taxon OID3300003432 Open in IMG/M
Scaffold IDJGI20214J51088_10158654 Open in IMG/M
Source Dataset NameWetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1598
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → unclassified Nitrososphaerales → Nitrososphaerales archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location
Location NameSacramento, California, United States
CoordinatesLat. (o)38.1072Long. (o)-121.6485Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065909Metagenome / Metatranscriptome127Y
F068525Metagenome124Y

Sequences

Protein IDFamilyRBSSequence
JGI20214J51088_101586541F065909AGGLLFMIVAKHTTEMCPGGVVLPDREFLTKLGESMKKSGVKEITGYTDAPSHVFYFVLETDNNIALNNAVEPLRLIGEVSIHPVLNLSEMSEWAKKIGIQK*
JGI20214J51088_101586543F068525GGTGGVSKVESELKEKIDEIIRQKAESSVSDELSDSEHGFIDALIWLKEGSIQLTNEGIGKEIVEQTYADKDASKEYCDGYDSALKLVLKILNEFKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.