NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FeGluNO3_10450511

Scaffold FeGluNO3_10450511


Overview

Basic Information
Taxon OID3300003471 Open in IMG/M
Scaffold IDFeGluNO3_10450511 Open in IMG/M
Source Dataset NameFe-reducing enrichment culture from wetland. Sample 5 with periodic nitrate additions.
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)559
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment → Wetland Sediment Microbial Communities From Dorn Creek, Dane County, Wisconsin, Usa, Enriched For Fe-Cycling Cultures

Source Dataset Sampling Location
Location NameDorn Creek (Dane County, WI)
CoordinatesLat. (o)43.135131Long. (o)-89.441777Alt. (m)Depth (m)0 to .3048
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096119Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
FeGluNO3_104505112F096119N/AMVFSPLVKRQVPFLHVPVRRFQIKNGLLSGDRFVGHWCQNATPNLNPNAHSRYKADRA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.