NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LVWS2TP113H_100379

Scaffold LVWS2TP113H_100379


Overview

Basic Information
Taxon OID3300003528 Open in IMG/M
Scaffold IDLVWS2TP113H_100379 Open in IMG/M
Source Dataset NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample LVWS2_TP1_13H
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)702
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location
Location NameAxial seamount, northeast pacific ocean
CoordinatesLat. (o)45.933251Long. (o)-130.01379Alt. (m)Depth (m)1542
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082613Metagenome / Metatranscriptome113N

Sequences

Protein IDFamilyRBSSequence
LVWS2TP113H_1003791F082613N/AQQSVVVAGLNATTKDAGIYATKIISVTTSASASNILIGHTNVGFAPWKVIPSRGVSSTTGASIGIDGTANITLQTTFANIADNAIFAGTFDVFSHSFLAALTASAFDTVDAREIGVRLKFNSWSSGNVRLDLSVSAKG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.