Scaffold Ba2Water_1004441

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ba2Water_1004441

Scaffold Ba2Water_1004441

Overview

Basic Information
Taxon OID	3300003536 Open in IMG/M
Scaffold ID	Ba2Water_1004441 Open in IMG/M
Source Dataset Name	Petroleum reservoir microbial communities from Reconcavo Basin, Brazil, analyzing oil degradation - Bahia-well BA-2 Water
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6109
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Kosmotogales → Kosmotogaceae → Mesotoga	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Petroleum Reservoir → Petroleum Reservoir Microbial Communities From Reconcavo Basin, Brazil, Analyzing Oil Degradation

Source Dataset Sampling Location
Location Name	Brazil: State of Brazil
Coordinates	Lat. (^o)	-12.2	Long. (^o)	-38.11	Alt. (m)		Depth (m)	500 to 1000
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070092	Metagenome	123	N

Sequences

Protein ID	Family	RBS	Sequence
Ba2Water_10044415	F070092	AGGAG	MAINDRLKPVMELLETNRQKIGLMISHGMASDLAIERRKKELYDEVMTAKENAFKEELADLEGEIKKIEYSYHEPKKDPTTKLLEFEQIKAKIRSTPSKELKELTHTFQNTGTIPGIPWERPDHVDVLVAELRNRGLDEEADLTWDYAYNKLKVDRPWENNPLYKQLKSQQNKVSVLAGFKDMLKYLDGTNNAVYISEILKYKG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.