Basic Information | |
---|---|
Taxon OID | 3300003912 Open in IMG/M |
Scaffold ID | Ga0063328_1036525 Open in IMG/M |
Source Dataset Name | Compost microbial communities from Sao Paulo Zoo, Brazil - ZC4 m-RNA DAY 15 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Sao Paulo, Virginia Bioinformatics Institute |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 576 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sao Paulo Zoo, Brazil | |||||||
Coordinates | Lat. (o) | -23.651072 | Long. (o) | -46.620675 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F059782 | Metagenome | 133 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0063328_10365252 | F059782 | GGAG | MRVEFETARGRVVPGKGSQVAAFFVALEIESEQLTVPERGELLQRLTTRIIDAIAEEFGGEEIEVRRPRE* |
⦗Top⦘ |