Scaffold Ga0064067_1108496

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0064067_1108496

Scaffold Ga0064067_1108496

Overview

Basic Information
Taxon OID	3300003972 Open in IMG/M
Scaffold ID	Ga0064067_1108496 Open in IMG/M
Source Dataset Name	Composted filter cake microbial communities from Nova Europa, Brazil, from a cane sugar milling plant
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Sao Paulo State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1453
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agaridevorans	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Filter Cake Produced In Cane Sugar Milling Plant → Composted Filter Cake Microbial Communities From Nova Europa, Brazil, From A Cane Sugar Milling Plant

Source Dataset Sampling Location
Location Name	Nova Europa, Brazil
Coordinates	Lat. (^o)	-21.818963	Long. (^o)	-48.614275	Alt. (m)		Depth (m)	.2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006009	Metagenome / Metatranscriptome	384	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0064067_11084962	F006009	GGAGG	MTHGEQKALWRGVAAGTMVGLAIGGMIALVIATKPGFFAALLQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.