Scaffold Ga0063354_1121111

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0063354_1121111

Scaffold Ga0063354_1121111

Overview

Basic Information
Taxon OID	3300004069 Open in IMG/M
Scaffold ID	Ga0063354_1121111 Open in IMG/M
Source Dataset Name	Combined assembly of 1362B_J2.571 and 1362A_J2.573
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	521
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal Fluid → Deep Subsurface And Oceanic Microbial Communities From Witwatersrand Basin, South Africa, And The Canadian And Fennoscandian Shields And At The Lost City Hydrothermal Field

Source Dataset Sampling Location
Location Name	Juan de Fuca Ridge flank, Pacific Ocean
Coordinates	Lat. (^o)	47.76	Long. (^o)	-127.76	Alt. (m)		Depth (m)	454
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003647	Metagenome / Metatranscriptome	475	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063354_11211112	F003647	N/A	RASNKAFAKVTMLKLDIDDYKRSLINGTYGGITYEEAEQVLEGYKTELKVWNYITELIEKQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.