NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066233_104260

Scaffold Ga0066233_104260


Overview

Basic Information
Taxon OID3300004322 Open in IMG/M
Scaffold IDGa0066233_104260 Open in IMG/M
Source Dataset NameSediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC3A
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)573
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Sediment → Metatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil

Source Dataset Sampling Location
Location NameSao Paulo State, Brazil
CoordinatesLat. (o)-23.8553Long. (o)-46.1394Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001346Metagenome / Metatranscriptome718Y
F001758Metagenome / Metatranscriptome640Y
F026580Metagenome / Metatranscriptome197Y

Sequences

Protein IDFamilyRBSSequence
Ga0066233_1042601F001758N/AVTGERLGQAGWLSPSQAGSQGSGAEAGFTSSSGGVRAPSVYAKEGLNGEER*
Ga0066233_1042602F026580GAGMRNRSESSQVARAGFELGRIAVTQRVFGCYCASARADGSGGLRKEVSQMKDAERRDKLSVRAGEDTWCGQDP*
Ga0066233_1042603F001346GGAGGVVWAGPVKTFRKVGDVKNNTADLWTKGNLRVKRRDPWHRANALSKAAADLELNGEDADKKTQTCLDLVRKPVAQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.