Basic Information | |
---|---|
Taxon OID | 3300004327 Open in IMG/M |
Scaffold ID | Ga0066231_103951 Open in IMG/M |
Source Dataset Name | Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC2B |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 621 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Sediment → Metatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sao Paulo State, Brazil | |||||||
Coordinates | Lat. (o) | -23.8553 | Long. (o) | -46.1394 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023129 | Metagenome / Metatranscriptome | 211 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0066231_1039511 | F023129 | N/A | MKGNLRDKRRDPWHRANALSKAAADPALSGQDANKQQQTCLGLVRKP |
⦗Top⦘ |