Scaffold Ga0071102_1012396

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0071102_1012396

Scaffold Ga0071102_1012396

Overview

Basic Information
Taxon OID	3300005056 Open in IMG/M
Scaffold ID	Ga0071102_1012396 Open in IMG/M
Source Dataset Name	Mid-Atlantic Ridge North Pond Expedition - Sample 1383C Shallow
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	The Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3068
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (14.29%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer → Deep Marine Subsurface Microbial Communities From Mid-Atlantic Ridge (Iodp Expedition 336)

Source Dataset Sampling Location
Location Name	North Pond, Atlantic Ocean
Coordinates	Lat. (^o)	22.8	Long. (^o)	-46.05	Alt. (m)		Depth (m)	70 to 146
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003081	Metagenome / Metatranscriptome	508	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071102_10123965	F003081	N/A	MREEMFEETRFGAEVFYMHVRGVDVIFVLTYLHILKKIYLKNYVTADGDG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.