NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070450_1488553

Scaffold Ga0070450_1488553


Overview

Basic Information
Taxon OID3300005064 Open in IMG/M
Scaffold IDGa0070450_1488553 Open in IMG/M
Source Dataset NameCompost microbial communities from Sao Paulo Zoo, Brazil - Zoo Compost 4 - DAY 01 soap2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCenter for Advanced Technologies in Genomics, Sao Paulo University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)518
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Source Dataset Sampling Location
Location NameSao Paulo Zoo, Brazil
CoordinatesLat. (o)-23.651072Long. (o)-46.620675Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046478Metagenome / Metatranscriptome151N

Sequences

Protein IDFamilyRBSSequence
Ga0070450_14885531F046478N/AMLAADVNCFWTLEQDQESYNREVYLPDAYIEVIINVGAPLLLESEYGMLELPRAFVNPLQHKPLRIRATGLCQLLSMQLYPWALKPILNIDATPSTVHVIGLDAGWQHFADELRRI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.