Basic Information | |
---|---|
Taxon OID | 3300005239 Open in IMG/M |
Scaffold ID | Ga0073579_1051030 Open in IMG/M |
Source Dataset Name | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1245 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Environmental Genome Shotgun Sequencing: Ocean Microbial Populations From The Gulf Of Maine |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gulf of Maine, USA | |||||||
Coordinates | Lat. (o) | 43.2393 | Long. (o) | -68.368612 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F071270 | Metagenome / Metatranscriptome | 122 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0073579_10510302 | F071270 | N/A | MPDAYTLAKQHLEAGVAEAENNNVDLNAYGQALVWKLIERYQESGRSNADIIKEIKYSLDNINDDNTFHVSRN* |
⦗Top⦘ |