Basic Information | |
---|---|
Taxon OID | 3300005298 Open in IMG/M |
Scaffold ID | Ga0071330_1041045 Open in IMG/M |
Source Dataset Name | Hot spring sediment microbial communities from Great Boiling Spring, Nevada - Cellulolytic enrichment Sediment 77C |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 23917 |
Total Scaffold Genes | 42 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 35 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → Archaeoglobi → Archaeoglobales → Archaeoglobaceae → Archaeoglobus → unclassified Archaeoglobus → Archaeoglobus sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Hot Spring Microbial Communities From Great Boiling Spring, Nevada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Great Boiling Spring, Nevada | |||||||
Coordinates | Lat. (o) | 40.71458 | Long. (o) | -119.369659 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F027047 | Metagenome | 196 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0071330_10410454 | F027047 | GAGG | MVEMDWSSLGIAVLSAVIYSLSMYVKKHLNPDNPQSFDKAKFLTTLIWGIIIGVVLQLSGVEITERTVEEQFVAYAGLIAITENIIKAVIRVTKIFTSFKEKNGGWSDGC* |
⦗Top⦘ |