Scaffold Ga0074217_10463

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074217_10463

Scaffold Ga0074217_10463

Overview

Basic Information
Taxon OID	3300005377 Open in IMG/M
Scaffold ID	Ga0074217_10463 Open in IMG/M
Source Dataset Name	Marine planktonic communities from Hawaii Ocean Times Series Station (HOT/ALOHA) - 3_Base_of_chrolophyll_max_130m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	792
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha)

Source Dataset Sampling Location
Location Name	North Pacific Ocean at depths of 10m to 4000m at the Hawaii open-ocean time-series station
Coordinates	Lat. (^o)	22.45	Long. (^o)	-158.0	Alt. (m)		Depth (m)	130
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007891	Metagenome / Metatranscriptome	343	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074217_104632	F007891	N/A	MTLYSNFFSSAINSVETKEKEVLITYSSNIAKEYVYNCENVPEFTNNLCSVLISNELQQDGGSVGSFVSQSRRDGVLTDQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.