Basic Information | |
---|---|
Taxon OID | 3300005377 Open in IMG/M |
Scaffold ID | Ga0074217_12969 Open in IMG/M |
Source Dataset Name | Marine planktonic communities from Hawaii Ocean Times Series Station (HOT/ALOHA) - 3_Base_of_chrolophyll_max_130m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 966 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pacific Ocean at depths of 10m to 4000m at the Hawaii open-ocean time-series station | |||||||
Coordinates | Lat. (o) | 22.45 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | 130 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023490 | Metagenome | 210 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0074217_129693 | F023490 | GGAGG | MILFPTHGWNTNFPISNTNSSVVYYRERPGPNFFRVFYKNVAQIRYTPKQVGAVFGVARFTPSVNELRDWCYEMVKEYGSETDKADDGYLKYIAKHGFGPEVHQDEDPTANTKMIV* |
⦗Top⦘ |