Scaffold Ga0074273_112137

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074273_112137

Scaffold Ga0074273_112137

Overview

Basic Information
Taxon OID	3300005378 Open in IMG/M
Scaffold ID	Ga0074273_112137 Open in IMG/M
Source Dataset Name	Marine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 52-4 In plume
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	504
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Subsurface Plume → Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Gulf of Mexico
Coordinates	Lat. (^o)	28.716667	Long. (^o)	-88.466667	Alt. (m)		Depth (m)	1210
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098669	Metagenome / Metatranscriptome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0074273_1121371	F098669	GAG	METATRSRKQKWRLKEAEGLGRKRRVEEAERRELHESDQGLDPGHGLNPGRKVRRIDQAMEGSPEIVPAKIRKKPCL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.