NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074273_140186

Scaffold Ga0074273_140186


Overview

Basic Information
Taxon OID3300005378 Open in IMG/M
Scaffold IDGa0074273_140186 Open in IMG/M
Source Dataset NameMarine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 52-4 In plume
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)530
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Subsurface Plume → Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico

Source Dataset Sampling Location
Location NameGulf of Mexico
CoordinatesLat. (o)28.716667Long. (o)-88.466667Alt. (m)Depth (m)1210
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002556Metagenome / Metatranscriptome548Y

Sequences

Protein IDFamilyRBSSequence
Ga0074273_1401861F002556N/AIGLEQFVTWATDHLITKVATIDIKSEVDFYHVEQYGEHQTLVFLEQAVTDPNSRAHASLYEFLLAIFTEVDSRSTGVLTFAEFDTLLSRAAEVPRTFGLAPPDASKEIRKQFFDSMNDAQMGGVTFRTLLAWTVEHTKGKIEAQKAGKGYKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.