NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068853_100061619

Scaffold Ga0068853_100061619


Overview

Basic Information
Taxon OID3300005539 Open in IMG/M
Scaffold IDGa0068853_100061619 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3245
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042033Metagenome / Metatranscriptome159Y
F044745Metagenome / Metatranscriptome154Y
F061313Metagenome / Metatranscriptome132Y
F081702Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0068853_1000616192F081702AGGAGMNDQTRVLIRQGSRELSREEVDQVGGGFNTLSITFGPNGRDGDGSLGES*
Ga0068853_1000616193F042033AGGAMDDQNRVLIRRGARSLNQEEIERVGGGISTTTLCTVPSTTCPNKDGDASIGECGHGC*
Ga0068853_1000616195F044745GGAMKYQNRVLIRKGARDLNEQEVAMVSGGLRTLTACTLAAAGTLDGDTFHSECGSPDQ*
Ga0068853_1000616196F061313AGGAGMNDHNRVLVRRGARDLTEKEVEQVCGGLRTATKCSVTASGAIDGDLHECS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.