Scaffold Ga0074229_102618

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074229_102618

Scaffold Ga0074229_102618

Overview

Basic Information
Taxon OID	3300005697 Open in IMG/M
Scaffold ID	Ga0074229_102618 Open in IMG/M
Source Dataset Name	Human fecal microbial communities J Craig Venter Institute, Maryland, USA - Subject 8
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	847
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The State University Of New York At Buffalo, New York, Usa, Of Three Healthy Adults

Source Dataset Sampling Location
Location Name	J Craig Venter Institute, Rockville, Maryland, USA
Coordinates	Lat. (^o)	39.134321	Long. (^o)	-77.181702	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067844	Metagenome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0074229_1026181	F067844	N/A	ASVWYLILNRKLQTLPIYITQLSSHLPRPLTMGTQQVSAGAAVITPQHRSYRVPQGSPQVFGGP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.