NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078746_1015098

Scaffold Ga0078746_1015098


Overview

Basic Information
Taxon OID3300005821 Open in IMG/M
Scaffold IDGa0078746_1015098 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAarhus University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1561
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark

Source Dataset Sampling Location
Location NameAarhus Bay station M5
CoordinatesLat. (o)56.10555Long. (o)10.463333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098055Metagenome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0078746_10150984F098055GGAMNEIRTKCDAETPHCEWCERPMTEEEHDFCDICDECREENELD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.