Scaffold Ga0101569_10110114

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0101569_10110114

Scaffold Ga0101569_10110114

Overview

Basic Information
Taxon OID	3300006625 Open in IMG/M
Scaffold ID	Ga0101569_10110114 Open in IMG/M
Source Dataset Name	Soil microbial communities from the Leymus chinensis steppe, China - after adding 10.5 g N m- 2, yr-1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chengdu Institute of Biology, Chinese Academy of Sciences
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	856
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_2_20CM_2_54_15_9cls	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The Leymus Chinensis Steppe, China - Nitrogen Deposition

Source Dataset Sampling Location
Location Name	the Inner Mongolia Grassland Ecosystem Research Station
Coordinates	Lat. (^o)	43.63	Long. (^o)	116.7	Alt. (m)		Depth (m)	.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010137	Metagenome / Metatranscriptome	308	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101569_101101142	F010137	GAG	MPRGGNKRHHFALNRILIGGLIVYVCAFAILLRNKSFDATDAVVVLIVFGIVFPLIAWIATRRAIPLSISITPSKSQLIVLFGYIIVLSVYLVGGPQWIDQHLPSSWIDSAQTRFFITLAKKLIVFVVIPLAIFRSGFGYRLRDFGIQSEGLRALRGTHLSVVVV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.