NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0101569_10898680

Scaffold Ga0101569_10898680


Overview

Basic Information
Taxon OID3300006625 Open in IMG/M
Scaffold IDGa0101569_10898680 Open in IMG/M
Source Dataset NameSoil microbial communities from the Leymus chinensis steppe, China - after adding 10.5 g N m- 2, yr-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChengdu Institute of Biology, Chinese Academy of Sciences
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)573
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp.(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The Leymus Chinensis Steppe, China - Nitrogen Deposition

Source Dataset Sampling Location
Location Namethe Inner Mongolia Grassland Ecosystem Research Station
CoordinatesLat. (o)43.63Long. (o)116.7Alt. (m)Depth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064003Metagenome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0101569_108986801F064003N/ASLSTSAEVELVVAPRSGISAVQIDLAKAHVLARDSVGREWVARMTGPTTATFEALPVGTYTLEFDLSDLTEPLVPRAPVSLLRVSGKDSKSITVTLDPRPIRMWNGSGSKAPPKTTPSAGDKGSTPPAAVPHS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.