Scaffold Ga0101569_11263468

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0101569_11263468

Scaffold Ga0101569_11263468

Overview

Basic Information
Taxon OID	3300006625 Open in IMG/M
Scaffold ID	Ga0101569_11263468 Open in IMG/M
Source Dataset Name	Soil microbial communities from the Leymus chinensis steppe, China - after adding 10.5 g N m- 2, yr-1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chengdu Institute of Biology, Chinese Academy of Sciences
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	633
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The Leymus Chinensis Steppe, China - Nitrogen Deposition

Source Dataset Sampling Location
Location Name	the Inner Mongolia Grassland Ecosystem Research Station
Coordinates	Lat. (^o)	43.63	Long. (^o)	116.7	Alt. (m)		Depth (m)	.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003258	Metagenome	497	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101569_112634682	F003258	AGGA	MRTLTPGQWYLRFTCEQCQQKEILFADLSRGQTKIKATYVVQCSSCSHTGSYDGDDIERYQHPSSPDT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.