 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300007084 Open in IMG/M |
| Scaffold ID | Ga0080113_1027120 Open in IMG/M |
| Source Dataset Name | Non-marine hypersaline water viral communities from Salar Uyuni, Bolivia - ZN 5 Uyuni 2014 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Alicante |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 669 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kirjokansivirales → Pyrstoviridae → Hatrivirus → Hatrivirus HATV3 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Salar Of Uyuni 2014 (Chile) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Salar Uyuni, Bolivia | |||||||
| Coordinates | Lat. (o) | -20.333333 | Long. (o) | -67.7 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F079661 | Metagenome | 115 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0080113_10271202 | F079661 | GGA | MSRTTIEIPSDLRDKLKAERKPHESNYGDTIERLLNDSDGGQLWTKREIQDVVQREIEEHTRR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |