Scaffold Ga0104854_10642770

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0104854_10642770

Scaffold Ga0104854_10642770

Overview

Basic Information
Taxon OID	3300007643 Open in IMG/M
Scaffold ID	Ga0104854_10642770 Open in IMG/M
Source Dataset Name	Biofilm microbial communities from a marine aquaculture plant in North Sea, Germany
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Max Planck Institute for Evolutionary Biology
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	10624
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (72.73%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Biofilm Marine Aquaculture Plant → Biofilm Microbial Communities From A Marine Aquaculture Plant In North Sea, Germany

Source Dataset Sampling Location
Location Name	Northern Germany
Coordinates	Lat. (^o)	54.13	Long. (^o)	8.8	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073087	Metagenome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104854_106427701	F073087	AGGA	MTRQHHTSFTSAILKSTQRLLRASSNGNLLASNHIDARTMRDIGISRVGMS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.