Scaffold Ga0118719_1218438

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0118719_1218438

Scaffold Ga0118719_1218438

Overview

Basic Information
Taxon OID	3300009373 Open in IMG/M
Scaffold ID	Ga0118719_1218438 Open in IMG/M
Source Dataset Name	Combined Assembly of Gp0127950, Gp0127951
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Georgia Genomics Facility
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	925
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location Name	Cariaco Basin, Venezuela
Coordinates	Lat. (^o)	10.5	Long. (^o)	-64.66	Alt. (m)		Depth (m)	143
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014123	Metagenome / Metatranscriptome	265	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118719_12184382	F014123	AGGAGG	MPRWIAIGTAPGWDDIKKLGDEMQATRNWRPDARTTIKTVHVLADGRLLAECHGPKQEDFEAWLQQKGWTVESITPIQLVANVGSIWEIK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.