 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300009448 Open in IMG/M |
| Scaffold ID | Ga0114940_10022933 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek Source |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2698 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cold Creek Source, Nevada | |||||||
| Coordinates | Lat. (o) | 36.41 | Long. (o) | -115.74 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F044411 | Metagenome / Metatranscriptome | 154 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114940_100229332 | F044411 | N/A | MTRSSSFNQIQPDKAIAICTREQAEQLVNYDHHQVTISERIGILLTAEWQPLESHVGPFILTVVFHNVQEYPPAPESIQAIVDSLKFQIRGQAR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |