Basic Information | |
---|---|
Taxon OID | 3300009542 Open in IMG/M |
Scaffold ID | Ga0116234_1086741 Open in IMG/M |
Source Dataset Name | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A SIP RNA (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 7647 |
Total Scaffold Genes | 13 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (61.54%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Washington | |||||||
Coordinates | Lat. (o) | 47.6525 | Long. (o) | -122.3049 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F064746 | Metagenome / Metatranscriptome | 128 | N |
F091989 | Metagenome / Metatranscriptome | 107 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116234_108674113 | F091989 | N/A | ARDIINRARVNCYATDASKASDALIRPFGEIDEQRARLKLLQESTRALCWIDATGGAVPFDEAEFNQVQREIANLQAKIDHNDDILDALDAKVAELGLAEFSLAKIKSQKEKLRGQIAQIRSEESDALRHKWESVVSLGGNRATYDKLPEVIEARAKAAAQIEPLEAEIKALNGQIRSLESILSKFKR* |
Ga0116234_10867413 | F064746 | GGAG | MNKIIWMALILLLGVFAIGGMSGTSGNDDAKNVTIDGYTFEGDFDNKWISGYGDTKTYKPANLEDQFGIPIGAYDWTGTENYNAFYYDSGEPSGSITKYGWAHIFVLKPDEDMANVLKSATRLLINPRNHRNAVVAGDLTEKYIEYNGRQAYLVEIKEELMDGFVDYRDYAAIAFFLDDGKVCVIDAFTTDNFGMSAWDIIDSIEL* |
⦗Top⦘ |