Basic Information | |
---|---|
Taxon OID | 3300009763 Open in IMG/M |
Scaffold ID | Ga0123340_1005072 Open in IMG/M |
Source Dataset Name | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 12505 |
Total Scaffold Genes | 13 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (53.85%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Nodule → Unclassified → Unclassified → Root Nodule → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mexico: Nepantla | |||||||
Coordinates | Lat. (o) | 19.09098 | Long. (o) | -98.87936 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F027116 | Metagenome | 195 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0123340_10050722 | F027116 | N/A | MVANCDQNNHQIRLWLLNNYKIKVIIEFCDQLSQDNLYLTLVTMNLVTYTIRF* |
⦗Top⦘ |