Scaffold Ga0123340_1019500

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0123340_1019500

Scaffold Ga0123340_1019500

Overview

Basic Information
Taxon OID	3300009763 Open in IMG/M
Scaffold ID	Ga0123340_1019500 Open in IMG/M
Source Dataset Name	Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5401
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Nodule → Unclassified → Unclassified → Root Nodule → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location Name	Mexico: Nepantla
Coordinates	Lat. (^o)	19.09098	Long. (^o)	-98.87936	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026491	Metagenome	197	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0123340_10195004	F026491	N/A	LPNEMVANCDQNSHQIKFWLLNNYKIEVMIEFSDQLS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.