NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0130085_1050789

Scaffold Ga0130085_1050789


Overview

Basic Information
Taxon OID3300009850 Open in IMG/M
Scaffold IDGa0130085_1050789 Open in IMG/M
Source Dataset NameSorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterQB3 Vincent J. Coates Genomics Sequencing Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)618
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Sorghum Rhizosphere Soil Microbial Communities From California, Usa

Source Dataset Sampling Location
Location NameCalifornia,USA
CoordinatesLat. (o)37.887207Long. (o)-122.304401Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021903Metagenome / Metatranscriptome216Y

Sequences

Protein IDFamilyRBSSequence
Ga0130085_10507891F021903N/ADLHSSNQILPYAKLVTDSAQGYGPEVVDFYGVPGQLALGFSSTYSAGAAANAYEVWVDRPNSSPNTDSAFTFLYDTNSFIVVYQADVGNGNKQILFDDRTKVPYAYGFYNTDQWNKVPTTATLWHILDISLVHQGFVYNGFPGENNTADTSATPGAKYGYDGQFFEKTKSIPCGHVASRGANPAYCPATLTYPQVKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.