Scaffold Ga0130085_1099166

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0130085_1099166

Scaffold Ga0130085_1099166

Overview

Basic Information
Taxon OID	3300009850 Open in IMG/M
Scaffold ID	Ga0130085_1099166 Open in IMG/M
Source Dataset Name	Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	QB3 Vincent J. Coates Genomics Sequencing Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3781
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales → Fiersviridae	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Sorghum Rhizosphere Soil Microbial Communities From California, Usa

Source Dataset Sampling Location
Location Name	California,USA
Coordinates	Lat. (^o)	37.887207	Long. (^o)	-122.304401	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028190	Metagenome / Metatranscriptome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0130085_10991662	F028190	AGGA	MASITVKKADGTTDIVFDNLAASGGDNSPAVWRQDTGAAAGLPVGLRSLFRVSSKWNGPKTARQVTFEFTQPYAVQDSTTTKYSATDRVVFNGVVTLPQAIPAANLNEVVQVLNLLASTLIKSAVQAGYAPS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.