NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134098_1015802

Scaffold Ga0134098_1015802


Overview

Basic Information
Taxon OID3300010265 Open in IMG/M
Scaffold IDGa0134098_1015802 Open in IMG/M
Source Dataset NameSwitchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 9_31_10_142_A3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1858
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading → Switchgrass Degrading Microbial Communities From High Solid Loading Bioreactors In New Hampshire, Usa

Source Dataset Sampling Location
Location NameUSA: Dartmouth College, New Hampshire
CoordinatesLat. (o)43.726Long. (o)-72.1429Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054066Metagenome / Metatranscriptome140N
F101228Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0134098_10158022F101228GAGGMTENYMNINRLCNAWYWVTERWKYFAVGVLAYLLIYCITGSNIQAVSGILIFMLMCLGVLWVNRLPHKDRVWCKRLVGITVILLAATVIITYNPVTALTITGEPSGDQIRWEITDGEPPYTVFVNGVEIVTDYPGTVVLTDSEPGKQYTAVVMDNESVADATVIGEYYTYPLWAWLLFAALLACLVVSIWLPYAAFGAAIAGGFLLLLIAPDPDYAPYLRIFAGAAFIVGLGGLAGRMQS
Ga0134098_10158024F054066AGGMFGRSRKPKELNRFRVGKGFPGLNAVMYRLMNKPYLDIRIFRGYRQITRIVTPDTGMRRFVVEGIGAFVMPNEDQMLRQLHDSHAYYINYNINSSAPGEITYDLEPVAFVYPPLSPAEFQIELEGQTVADLLAETEKDMSWLWLLAGGAVLIFVLILIFGGV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.