NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0138898_100610

Scaffold Ga0138898_100610


Overview

Basic Information
Taxon OID3300010939 Open in IMG/M
Scaffold IDGa0138898_100610 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from North Pond, Atlantic Mid-Ocean Ridge - NP_1384A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5785
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From North Pond, Atlantic Mid-Ocean Ridge.

Source Dataset Sampling Location
Location NameNorth Pond, Atlantic Ocean
CoordinatesLat. (o)22.81Long. (o)-46.09Alt. (m)Depth (m)4476
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029588Metagenome / Metatranscriptome188Y

Sequences

Protein IDFamilyRBSSequence
Ga0138898_1006109F029588N/AMEVKMTKYSFWIGLGKTAKNSAYLLVPFALALLATVPAGYAWLAGPIVYLLKNYLENK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.