Scaffold Ga0138898_114023

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0138898_114023

Scaffold Ga0138898_114023

Overview

Basic Information
Taxon OID	3300010939 Open in IMG/M
Scaffold ID	Ga0138898_114023 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from North Pond, Atlantic Mid-Ocean Ridge - NP_1384A
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	793
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From North Pond, Atlantic Mid-Ocean Ridge.

Source Dataset Sampling Location
Location Name	North Pond, Atlantic Ocean
Coordinates	Lat. (^o)	22.81	Long. (^o)	-46.09	Alt. (m)		Depth (m)	4476
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019543	Metagenome / Metatranscriptome	229	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138898_1140231	F019543	N/A	MTKDTRLTFRVQSGLKKNLEVIAAREGRSVAQICEAFLKAGSEGYKKKGPKYLQRFLSRQKKEDAR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.