NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0138905_1339150

Scaffold Ga0138905_1339150


Overview

Basic Information
Taxon OID3300010947 Open in IMG/M
Scaffold IDGa0138905_1339150 Open in IMG/M
Source Dataset NameTermite gut microbial communities - laboratory nests. Combined Assembly of Gp0151227, Gp0151152, Gp0151149, Gp0151146
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Luxembourg, Luxembourg Institute of Science and Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1251
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study

Source Dataset Sampling Location
Location NameFrance
CoordinatesLat. (o)48.913957Long. (o)2.485499Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050745Metagenome145Y

Sequences

Protein IDFamilyRBSSequence
Ga0138905_13391502F050745GAGGMFFKRLVLGKGGVDDVRREPADSSDNAVSVAMAHWNVEHRVFAVEQFFLETVIL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.