NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0138354_100688

Scaffold Ga0138354_100688


Overview

Basic Information
Taxon OID3300011275 Open in IMG/M
Scaffold IDGa0138354_100688 Open in IMG/M
Source Dataset NameMetatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2919 (Metagenome Metatranscriptome) (version 2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)557
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Pelagophyceae → Pelagomonadales → Pelagomonas → Pelagomonas calceolata(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameWest of Santa Cruz de la Palma, Atlantic Ocean
CoordinatesLat. (o)29.97Long. (o)-23.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018182Metagenome / Metatranscriptome236N

Sequences

Protein IDFamilyRBSSequence
Ga0138354_1006881F018182AGAAGMTSNISMKDTRDGVVVKADGRTLLAKLVFAGSARLAECDLGIEELRAAFKKAHGEEASKGTLTYQLNENDEDALQLLDDADLALAKKHGSEPLKITSTEVDSRNVFDHASSELAKHGLDAPPTELKKLLDVLQFKPRRLVKCGLAPPKALKNTLKGDEAEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.