NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0122010_112685

Scaffold Ga0122010_112685


Overview

Basic Information
Taxon OID3300011722 Open in IMG/M
Scaffold IDGa0122010_112685 Open in IMG/M
Source Dataset NameUrban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway plastic -P00359
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterWeill Cornell Medical College
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)568
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → City → Subway → Unclassified → City Subway Plastic → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Source Dataset Sampling Location
Location NameUSA:New York City
CoordinatesLat. (o)40.55Long. (o)-74.13Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028713Metagenome / Metatranscriptome190Y

Sequences

Protein IDFamilyRBSSequence
Ga0122010_1126851F028713GAGGMIEEKKVLLVKVDTLKNIADALTKSVSSKKFSWCRETMCIAGLDK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.