NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120379_1004180

Scaffold Ga0120379_1004180


Overview

Basic Information
Taxon OID3300011979 Open in IMG/M
Scaffold IDGa0120379_1004180 Open in IMG/M
Source Dataset NameSheep rumen microbial communities from Wyoming, USA - O_aries_Con_1396
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Missouri
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5423
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (13.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → unclassified Prevotella → Prevotella sp. E2-28(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Ruminant Gut Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)41.314168Long. (o)-105.584589Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039427Metagenome / Metatranscriptome163Y
F061418Metagenome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0120379_10041805F039427N/AMSKKTLTFVTGIVTAVQTAAVAAVTYYVNDNAAAINSAIVIAGGAIIEICNLFVKPE*
Ga0120379_10041806F061418N/AMSKRNETLQALCRDYLCKLRHMGKKHGIDVDGLIRLNRQKKCEATQHEVELLSRAVDDERLSRSEVPKILDKSYRQANEDGDFDRIKKLKHQGIYSKVSALLYKNRK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.