NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0160490_100371

Scaffold Ga0160490_100371


Overview

Basic Information
Taxon OID3300012822 Open in IMG/M
Scaffold IDGa0160490_100371 Open in IMG/M
Source Dataset NameEnriched soil microbial communities from UW Madison campus, WI, USA - DID2934_E24_Lignin MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6421
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (10.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Source Dataset Sampling Location
Location NameUSA: Madison, Wisconsin
CoordinatesLat. (o)43.073Long. (o)-89.4011Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071840Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0160490_1003714F071840N/AVYGLYNSYYILNSFEFIMVGLLLLFASIVCVNLSKFNKNIKINNYYELLTLYDFFNDFVNFLFMRKQNLNNQTIANVSTRIFKKKTNK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.