NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0164303_10034321

Scaffold Ga0164303_10034321


Overview

Basic Information
Taxon OID3300012957 Open in IMG/M
Scaffold IDGa0164303_10034321 Open in IMG/M
Source Dataset NameSoil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2116
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Amended Soil Microbial Communities From New York, Usa To Study Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Mt. Pleasant research farm, Cornell University, New York
CoordinatesLat. (o)42.4531Long. (o)-76.3842Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002111Metagenome / Metatranscriptome592Y
F008327Metagenome / Metatranscriptome335Y
F077140Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0164303_100343213F002111N/AMAAIAAPPFVSYSSLTEAEIPAEQWPTVYSSLQALKGHVQEYPGCQSFDVFVRAEGAGDVLVHCYTTWDTPGQLEVFLERGYTFERLLADIGSGLEATRSLVMEKLF*
Ga0164303_100343214F008327AGGAGGMSFPKGDSPEDVRQFYLYLNGHQETTHPVQTWHVDWLSLAWLWGFVIVLVCVLLLWVKQYRTTRQRTGIYPVDSFGGWTTVGAGPATVFFLLFTAVIVVFAVVLIVGHIVYGQKF*
Ga0164303_100343216F077140N/ADKFLLNDGKTPLSLKDAAAGIKAIYEDLLNRAWNEARARGDKLPDESQKLIPPTVPGQQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.