NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0117782_113727

Scaffold Ga0117782_113727


Overview

Basic Information
Taxon OID3300013737 Open in IMG/M
Scaffold IDGa0117782_113727 Open in IMG/M
Source Dataset NameCoral viral communities from the Great Barrier Reef, Australia - Pocillopora damicornis (fresh isolate) - PDam_DNA_MDA_NLN
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAustralian Institute of Marine Science
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)573
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Coral Tissue → Coral Viral Communities From The Great Barrier Reef, Australia

Source Dataset Sampling Location
Location NameAustralia: Great Barrier Reef
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035988Metagenome171Y

Sequences

Protein IDFamilyRBSSequence
Ga0117782_1137271F035988N/AVKQLLETREIPLDKEDCNQTNGECTLITKPVIFIKGIQTRSQLEHYCQVPAATVRNWSKGRYTLRILINPATPKTSQIGVYAKFEGMTEGATGSQWVPLTSKGELEDKMLRCIQDRLQGGNCENIK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.