Basic Information | |
---|---|
Taxon OID | 3300014228 Open in IMG/M |
Scaffold ID | Ga0135143_10027 Open in IMG/M |
Source Dataset Name | Indoor hospital air microbial communities from San Diego, USA - 211_L1_2014-6-9 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | San Diego State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 683 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Air → Indoor Air → Unclassified → Unclassified → Indoor Hospital Air → Indoor Hospital Air Microbial Communities From San Diego, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: San Diego, California | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F065766 | Metagenome / Metatranscriptome | 127 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0135143_100271 | F065766 | N/A | MADEKKDEGAGDPIKILLEEALERQRNAMMDSFVQI |
⦗Top⦘ |