Scaffold Ga0134319_105362

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134319_105362

Scaffold Ga0134319_105362

Overview

Basic Information
Taxon OID	3300014652 Open in IMG/M
Scaffold ID	Ga0134319_105362 Open in IMG/M
Source Dataset Name	Alkaline hot spring microbial communities from Galicia, Spain - Lobios hot spring
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	The University of A Coru?a
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	872
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Alkaline Hot Spring → Alkaline Hot Spring Microbial Communities From Galicia, Spain

Source Dataset Sampling Location
Location Name	Spain: Lobios, Galicia
Coordinates	Lat. (^o)	41.86113	Long. (^o)	-8.1062	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023133	Metagenome / Metatranscriptome	211	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134319_1053621	F023133	GGAG	MTIRPLNRSLAKQDPEGTFESPLGIVEERLFTRGEKIATLNRWRQAILEELAALGEVRRARLLGE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.